PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 464aa    MW: 51196.2 Da    PI: 8.2084
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603130.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.82.9e-30229284359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     DgynWrKYG K+vk se+prsYY+Ct+ +Cpvkkkvers  d++++eitY+g+Hnhe
  XP_009603130.1 229 DGYNWRKYGEKKVKASECPRSYYKCTHLKCPVKKKVERSV-DGHITEITYNGRHNHE 284
                     9***************************************.***************7 PP

2WRKY106.61.3e-33395453159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  XP_009603130.1 395 LDDGYKWRKYGQKVVKGNQHPRSYYRCTYPGCNVRKQVERASSDPKTVITTYEGKHNHD 453
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.423222286IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-26224286IPR003657WRKY domain
SuperFamilySSF1182901.57E-23226286IPR003657WRKY domain
SMARTSM007744.2E-32227285IPR003657WRKY domain
PfamPF031062.1E-22229284IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-36381455IPR003657WRKY domain
SuperFamilySSF1182904.45E-30387455IPR003657WRKY domain
PROSITE profilePS5081135.921390455IPR003657WRKY domain
SMARTSM007741.0E-39395454IPR003657WRKY domain
PfamPF031061.1E-26396453IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MGETGGASAM SFPALTIPPR PSFESFFSNM PSFSPGPMSL VSSFFSDQSP DSSDYPSFSQ  60
LLAGAMASPL AKPAFLPDNS GEGSQKNSGY KQNRPMDLVL AQSPLFMIPP GLSPSGLLNS  120
PGFLPPLQSP FGMSHQQALA HVTAQAAFSN SYMQMQAEDQ CSSQVASAEA LGHELTTELK  180
EASLQLKEPS QTRMDSEPSD KQGKKFELQE FSQSENKPSF VAIEKPACDG YNWRKYGEKK  240
VKASECPRSY YKCTHLKCPV KKKVERSVDG HITEITYNGR HNHELPQPNK QRKDGSALVG  300
TDCSEVRPEH DSPVMNSSDG SSHTRSDRVS NQMVSELLVK SEYDETKNVL VAVDEGHDGP  360
NAKRTKTAVK TLPSSHGTVA ESKIVLQTRS EVDFLDDGYK WRKYGQKVVK GNQHPRSYYR  420
CTYPGCNVRK QVERASSDPK TVITTYEGKH NHDIPTVRNR NSQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-36229455877Probable WRKY transcription factor 4
2lex_A6e-36229455877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0635740.0AB063574.1 Nicotiana tabacum NtWRKY-7 mRNA for WRKY DNA-binding protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603130.10.0PREDICTED: probable WRKY transcription factor 3
TrEMBLA0A0P0UVE60.0A0A0P0UVE6_NICBE; Transcription factor
STRINGPGSC0003DMT4000036370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-115WRKY DNA-binding protein 4